PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0059s0450.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 512aa    MW: 55411.1 Da    PI: 8.8696
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0059s0450.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.26.7e-24208252145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+ep+rC+RtDGKkWRCsr+v +++k+CErH h++r rsrk++e+
  SapurV1A.0059s0450.1.p 208 DPEPWRCKRTDGKKWRCSRDVAPDQKYCERHSHKSRPRSRKPVES 252
                             79****************************************986 PP

2QLQ51.82.4e-18145180237
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                              FTaaQlq+L++Q ++yKy++a++ vPpeLl++i+k
  SapurV1A.0059s0450.1.p 145 LFTAAQLQELERQTTIYKYMVASAAVPPELLMPITK 180
                             5*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-10144180IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.706145180IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.4E-13146178IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.1208252IPR014977WRC domain
PfamPF088791.6E-19209251IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MFEAKEAKKK LLAKKASSLL RNFINSTCEF KLTNSLAPAS VLGCKILMNV VSVMVMSCHH  60
KPAAHELSSS RSGGGGGGGG GPTFYRASNH VACFGGINDA VASMSAITGA VAVTKSLQYP  120
YSNSDSSLFT SNSSGEMTSV NERVLFTAAQ LQELERQTTI YKYMVASAAV PPELLMPITK  180
NQSNVLTSQS NMLTGSLGLV IPSCNSPDPE PWRCKRTDGK KWRCSRDVAP DQKYCERHSH  240
KSRPRSRKPV ESNTHDFPRS MTSTINNNYS TNTQLFNKKP HFPRNLYMFP GVMASSVTSY  300
DQPRELGKAL ERRDFTCFYN SSQEWQHLTR DVIKGYHNVN DIDRESVHSL QSQRLNDHCS  360
MFLSPKSTAL DRALNHSQTQ AQVTWHFIDA CPANSGRDNI CKNTHVSSSE TSALPHSALT  420
LSMSSGSQSE TSNEGNGSAQ LGSSGIVGTT DRDHQSVNGL IRPQWTMTHG GSWPGGPLAE  480
ALCLGISGHA KTASNLASPC SSSCGPSADK N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1085414e-31DQ108541.1 Corchorus olitorius SSR marker J142-M13F genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002297943.10.0hypothetical protein POPTR_0001s11480g
TrEMBLB9GK640.0B9GK64_POPTR; Uncharacterized protein
STRINGPOPTR_0001s11480.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF138941621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24150.15e-33growth-regulating factor 8